Structure of PDB 4v6i Chain Bp

Receptor sequence
>4v6iBp (length=40) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
YNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBp
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bp Y13 N14 K17 V19 R21 Y24 R26 P28 P29 R30 A31 T32 N33 R35 G40 H41 N43 Q44 R46 P47 K49 K50 L51 K52 Y1 N2 K5 V7 R9 Y12 R14 P16 P17 R18 A19 T20 N21 R23 G28 H29 N31 Q32 R34 P35 K37 K38 L39 K40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]