Structure of PDB 4v5z Chain Bp

Receptor sequence

>4v5zBp (length=159) Species: 9615 (Canis lupus familiaris)

RLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVS
RARCRKNTLARRKGRHMGTANARMPEKVTWMRRMRILRRLLRRYRESKKI
DRHMYHSLYLKVKGNDKARKKLLADQAEARRSKTKEARKRREERLQAKKE
EIIKTLSKE

3D structure

• PDB: 4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
• Chain: Bp
• Resolution: 8.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bp	S37 R38 R42 S59 R60 R62 R74 H75 T84 R88 R103 H118 Y120 H121 Y124	S29 R30 R34 S50 R51 R53 R65 H66 T69 R73 R88 H103 Y105 H106 Y109
BS02	rna	Bp	Q39 K43	Q31 K35
BS03	rna	Bp	A61 R64	A52 R55
BS04	peptide	Bp	K190 E191	K158 E159

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:26:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Bp', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Bp', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '4v5z', asym_id = 'Bp'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0022625', uniprot='', pdbid='4v5z', asym_id='Bp')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>