Structure of PDB 8ove Chain Bo

Receptor sequence
>8oveBo (length=89) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
AKRTVKMGVMGRYGARYGSNPRKRAKKLEVSQHAKHFCSFCGKFAFRRKA
VGIWRCDGCSKTVAGGAYTLSTPNNTTVRSTVRRLRELK
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainBo
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bo K3 R4 T5 G9 G12 R13 R17 K2 R3 T4 G8 G11 R12 R16
BS02 rna Bo T5 V6 K7 M8 A16 Y18 G19 S20 N21 R23 F41 K62 T4 V5 K6 M7 A15 Y17 G18 S19 N20 R22 F40 K61
BS03 rna Bo R13 E30 H34 C42 R49 A51 Y69 R12 E29 H33 C41 R48 A50 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38AW9

[Back to BioLiP]