Structure of PDB 6skg Chain Bo

Receptor sequence
>6skgBo (length=43) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
VLKAIKIEDRDGEILFRCPRCGMVFRSAKAYTRHVNKAHGHLF
3D structure
PDB6skg Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBo
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bo V3 L4 K8 R22 C23 K31 T34 R35 N38 K39 A40 H41 V1 L2 K6 R20 C21 K29 T32 R33 N36 K37 A38 H39
BS02 ZN Bo C23 H36 H41 C21 H34 H39
External links