Structure of PDB 4v8z Chain Bo

Receptor sequence

>4v8zBo (length=105) Species: 4932 (Saccharomyces cerevisiae)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

• PDB: 4v8z Molecular architecture of a eukaryotic translational initiation complex.
• Chain: Bo
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bo	V2 T10 Y11 K15 H20 Y28 G31 F36 Q38 R41 R42 R45 K46 G49 F50 G52 Q53 T54 K55 P56 V57 K60 A62 K63 T65 K66 K67 V69 T79 R80 Q82 T84 C88 K89 K98	V1 T9 Y10 K14 H19 Y27 G30 F35 Q37 R40 R41 R44 K45 G48 F49 G51 Q52 T53 K54 P55 V56 K59 A61 K62 T64 K65 K66 V68 T78 R79 Q81 T83 C87 K88 K97
BS02	rna	Bo	L104 Q105 F106	L103 Q104 F105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
• PDBsum: 4v8z
• PubMed: 24200810
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)