Structure of PDB 8ova Chain Bn

Receptor sequence

>8ovaBn (length=80) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

TKGTTSMGQRHGRTHILCRRCGRNAYHVQWERCAACAYPRAQRRRYNWSV
KAIKRRRTGTGRCRYLKVVHRRIRNHFKTD

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bn	K3 G4 T5 S7 M8 Q10 R11 H12 G13 R14 T15 H16 R24 N25 H28 Q30 R33 A35 R41 Q43 R44 R45 R46 Y47 N48 W49 V51 K52 K55 R56 R58 H71 R75 H77 F78 K79	K2 G3 T4 S6 M7 Q9 R10 H11 G12 R13 T14 H15 R23 N24 H27 Q29 R32 A34 R40 Q42 R43 R44 R45 Y46 N47 W48 V50 K51 K54 R55 R57 H70 R74 H76 F77 K78
BS02	rna	Bn	T2 K3 T5 T6 M8 G9 Q10	T1 K2 T4 T5 M7 G8 Q9
BS03	rna	Bn	R20 R21 T59 G62 R63 C64 R65 Y66 L67 R72 R73 N76 H77 T80 D81	R19 R20 T58 G61 R62 C63 R64 Y65 L66 R71 R72 N75 H76 T79 D80
BS04	ZN	Bn	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links