Structure of PDB 6gb2 Chain Bn

Receptor sequence

>6gb2Bn (length=97) Species: 9823 (Sus scrofa) [Search protein sequence]

FHVRVTLPPRKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIKGPIWLR
GWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISYLYKHFNRHGKYR

3D structure

PDB

6gb2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bn	F32 H33 V34 R35 V36 R41 R46 K50 R51 K68 H69 P70 K75 P77 I78 W79 K95 R96 M97 N100 H108 K112 R113 S115 Y116 Y118 K119 H120 F121 R123 H124 G125 K126 Y127	F1 H2 V3 R4 V5 R10 R15 K19 R20 K37 H38 P39 K44 P46 I47 W48 K64 R65 M66 N69 H77 K81 R82 S84 Y85 Y87 K88 H89 F90 R92 H93 G94 K95 Y96

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit

External links