Structure of PDB 4v5z Chain Bn

Receptor sequence
>4v5zBn (length=236) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
AYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI
ICQIAYARIEGDMIVCARYAHELPKYGVKVGLTNYAAAYCTGLLLARRLL
NRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVF
GALKGAVDGGLSIPHSTKRFPGYDSESKEFAEVHRKHIMGQNVADYMRYL
MEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAI
3D structure
PDB4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
ChainBn
Resolution8.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bn R22 Y30 R34 I37 R13 Y21 R25 I28
BS02 rna Bn P46 K47 G120 Q121 P37 K38 G111 Q112
BS03 rna Bn Y11 F12 K13 Q16 V17 K18 F19 R21 T27 R53 N56 R57 H80 K196 D216 Y218 K219 Y2 F3 K4 Q7 V8 K9 F10 R12 T18 R44 N47 R48 H71 K186 D206 Y208 K209
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 04:32:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Bn', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Bn', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '4v5z', asym_id = 'Bn'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='4v5z', asym_id='Bn')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>