Structure of PDB 8ove Chain Bm

Receptor sequence
>8oveBm (length=98) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
APVPRTGIIAGFNKGYKTTRRARRPSSNDRYALPHKKLRAVKAIISDLVG
FSPMERRVQELLRVGKDKRALKFCKKRLGSIKAAKKRRAKVEEALRQQ
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainBm
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bm Y23 N35 R37 Y38 A39 P41 H42 K44 R46 K49 R84 L85 K89 K93 R94 K97 Y16 N28 R30 Y31 A32 P34 H35 K37 R39 K42 R77 L78 K82 K86 R87 K90
BS02 rna Bm E67 R70 K73 E60 R63 K66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38CY6

[Back to BioLiP]