Structure of PDB 4v6i Chain Bm

Receptor sequence
>4v6iBm (length=92) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRG
AAGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBm
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Bm M1 A2 K3 R4 T5 K6 G9 K13 G15 V16 R17 Y18 G19 S20 S21 L22 I31 H34 R36 F41 C42 K44 K48 R49 A51 Y69 M1 A2 K3 R4 T5 K6 G9 K13 G15 V16 R17 Y18 G19 S20 S21 L22 I31 H34 R36 F41 C42 K44 K48 R49 A51 Y69
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Feb 21 18:02:04 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v6i', asym_id = 'Bm', title = 'Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v6i', asym_id='Bm', title='Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v6i', asym_id = 'Bm'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v6i', asym_id='Bm')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>