Structure of PDB 8ove Chain Bl

Receptor sequence

>8oveBl (length=144) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

KFSGSVAANRSKKIHQLTKKTTRVKRDRKSPRLYMKGTLAGYTRGLHGQN
KNTALVRIENVNTTEDAKWYVGKRVCYVYHGYKIKRCVRWSKAPARRSNT
RAIWGRITRPHGTSGTVRVKFNGSSVPASAIGRRIRVYLYPSRI

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bl	R49 L51 H52 G53 Q54 K56 N67 E70 R79 Y84 Y87 K88 R91 R94 S96 K97 R106 R111 R114 H116 G117 T118 S119 R123 K125 N127 S129 S130 P132 A133	R44 L46 H47 G48 Q49 K51 N62 E65 R74 Y79 Y82 K83 R86 R89 S91 K92 R101 R106 R109 H111 G112 T113 S114 R118 K120 N122 S124 S125 P127 A128
BS02	rna	Bl	F7 S8 G9 A13 N14 S16 K17 K18 H20 Q21	F2 S3 G4 A8 N9 S11 K12 K13 H15 Q16
BS03	rna	Bl	R28 V29 K30 R31 D32 R33 K34 S35 P36 R37 K41 R79 V83 H85 R94 A98 R101 S103 N104 T105 W109 R139 R141 Y145	R23 V24 K25 R26 D27 R28 K29 S30 P31 R32 K36 R74 V78 H80 R89 A93 R96 S98 N99 T100 W104 R134 R136 Y140

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

External links