Structure of PDB 8oin Chain Bl

Receptor sequence
>8oinBl (length=38) Species: 9823 (Sus scrofa) [Search protein sequence]
FKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM
3D structure
PDB8oin Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
ChainBl
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bl F63 K64 T65 K66 G67 V68 K70 K71 R72 K80 R81 R82 W85 F86 Y88 P93 Q99 M100 F1 K2 T3 K4 G5 V6 K8 K9 R10 K18 R19 R20 W23 F24 Y26 P31 Q37 M38
BS02 ZN Bl C73 C89 H95 C11 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oin, PDBe:8oin, PDBj:8oin
PDBsum8oin
PubMed37141370
UniProtA0A287A731

[Back to BioLiP]