Structure of PDB 7o80 Chain Bl

Receptor sequence

>7o80Bl (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL

3D structure

PDB

7o80 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bl	S2 S3 H4 K5 K10 L13 W28 K34 I35 R36 Y37 S39 R42 H43 W44 R45 K48 L49 L51	S1 S2 H3 K4 K9 L12 W27 K33 I34 R35 Y36 S38 R41 H42 W43 R44 K47 L48 L50
BS02	rna	Bl	T6 F7 R8 R11 K15 K18 Q19 R21 I23 P24 W26 I27 M29 K30 T31 I35 K40	T5 F6 R7 R10 K14 K17 Q18 R20 I22 P23 W25 I26 M28 K29 T30 I34 K39

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links