Structure of PDB 6uz7 Chain Bl

Receptor sequence

>6uz7Bl (length=49) Species: 28985 (Kluyveromyces lactis)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMN

3D structure

• PDB: 6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
• Chain: Bl
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bl	A2 A3 Q4 K5 K10 M13 P22 A39 R41 R42 W44 R45 K48 N50	A1 A2 Q3 K4 K9 M12 P21 A38 R40 R41 W43 R44 K47 N49
BS02	rna	Bl	F7 R8 K12 K15 Q19 R21 L23 P24 W26 I27 L29 T31 K40	F6 R7 K11 K14 Q18 R20 L22 P23 W25 I26 L28 T30 K39

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 21:09:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6uz7', asym_id = 'Bl', title = 'Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6uz7', asym_id='Bl', title='Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6uz7', asym_id = 'Bl'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6uz7', asym_id='Bl')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>