Structure of PDB 6th6 Chain Bl

Receptor sequence

>6th6Bl (length=93) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]

MKYPKQIRTYCPFCKRHTIHKVEKVKKRPRSELSAGQRRFRRKLKGYTGF
PRPNPAGREKPVKKLDLRFRCTVCGKAHTRGQGFRVKKFELVE

3D structure

PDB

6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bl	M1 P4 R8 H17 R28 S31 L33 R38 R39 R42 K43 G46 Y47 G49 F50 R52 P53 N54 R58 E59 K60 K63 K64 D66 R68 K76 A77 R80 R85	M1 P4 R8 H17 R28 S31 L33 R38 R39 R42 K43 G46 Y47 G49 F50 R52 P53 N54 R58 E59 K60 K63 K64 D66 R68 K76 A77 R80 R85
BS02	ZN	Bl	C71 C74	C71 C74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links