Structure of PDB 6skf Chain Bl

Receptor sequence
>6skfBl (length=93) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
MKYPKQIRTYCPFCKRHTIHKVEKVKKRPRSELSAGQRRFRRKLKGYTGF
PRPNPAGREKPVKKLDLRFRCTVCGKAHTRGQGFRVKKFELVE
3D structure
PDB6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBl
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bl M1 K2 Y3 R8 R16 H17 R28 S31 L33 R38 R42 K43 G46 Y47 T48 G49 F50 P51 R52 P53 R58 E59 K60 K64 D66 R68 K76 R80 G81 K87 M1 K2 Y3 R8 R16 H17 R28 S31 L33 R38 R42 K43 G46 Y47 T48 G49 F50 P51 R52 P53 R58 E59 K60 K64 D66 R68 K76 R80 G81 K87
BS02 ZN Bl C11 C71 C11 C71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum6skf
PubMed32555463
UniProtQ5JE51

[Back to BioLiP]