Structure of PDB 4v8y Chain Bl

Receptor sequence
>4v8yBl (length=50) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB4v8y Molecular architecture of a eukaryotic translational initiation complex.
ChainBl
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bl A2 A3 Q4 K5 F7 K10 M13 P22 A39 R41 R42 N43 W44 R45 K48 M49 A1 A2 Q3 K4 F6 K9 M12 P21 A38 R40 R41 N42 W43 R44 K47 M48
BS02 rna Bl F7 R8 K12 K15 K18 Q19 R21 L23 W26 L29 R30 T31 I35 K40 F6 R7 K11 K14 K17 Q18 R20 L22 W25 L28 R29 T30 I34 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum4v8y
PubMed24200810
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]