Structure of PDB 4v5z Chain Bl

Receptor sequence
>4v5zBl (length=122) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
RKTRKLRGHVSHGHGRIGKHHPGGRGNAGGMHHHRINFDKYHSFCPTVNL
DKPWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLPKQPVIVK
AKFFSRRAEEKIKSVGGACVLV
3D structure
PDB4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
ChainBl
Resolution8.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bl R6 G13 H14 V15 R21 K24 H25 H28 P29 R32 G33 M38 H39 R132 R1 G8 H9 V10 R16 K19 H20 H21 P22 R25 G26 M31 H32 R107
BS02 rna Bl E135 K136 E110 K111
BS03 rna Bl R131 E135 R106 E110
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 04:53:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Bl', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Bl', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v5z', asym_id = 'Bl'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='4v5z', asym_id='Bl')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>