Structure of PDB 8ove Chain Bk

Receptor sequence
>8oveBk (length=123) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
IVKIRDLKEKGKDDLLKQLSEFKKELSQLRVSQQMNVGAARLGRIRTIRK
GIARIMTVLNKNERENLRKFYSDKKLRSAKPKTLRAKLTHRRRLALKANE
KNRKTRRQLRMAHKFPRRIYAVK
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainBk
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bk R80 R88 H93 R94 N105 K107 R109 R110 R113 H116 R77 R85 H90 R91 N102 K104 R106 R107 R110 H113
BS02 rna Bk A42 R52 A56 R57 M59 T60 N63 R67 K85 K90 T92 H93 R94 R96 A39 R49 A53 R54 M56 T57 N60 R64 K82 K87 T89 H90 R91 R93
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38FW8

[Back to BioLiP]