Structure of PDB 4v6i Chain Bk

Receptor sequence
>4v6iBk (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVA
KKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBk
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bk P24 S51 P52 Y53 E54 R55 R56 I61 R68 R76 R82 N91 A95 R98 R99 P1 S28 P29 Y30 E31 R32 R33 I38 R45 R53 R59 N68 A72 R75 R76
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]