Structure of PDB 8ove Chain Bj

Receptor sequence

>8oveBj (length=116) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

CPRVQYRRRMHYATRGNRMRLVRTPGNRLVMQKRGKRSQGPHTPWVLGHK
RLAGTKALRHTKARLAPRHQKTTSRPYGGVLSHEQVRDRIVRAFLIEEQR
IVKRALKAHAKVQKEK

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bj	R5 Q7 R9 R11 H13 Y14 T16 T26 G28 R30 Q34 K38 R61 H62	R3 Q5 R7 R9 H11 Y12 T14 T24 G26 R28 Q32 K36 R59 H60
BS02	rna	Bj	R5 V6 Y8 R11 R94 I98 R102 K105	R3 V4 Y6 R9 R92 I96 R100 K103
BS03	rna	Bj	C3 R17 L23 R25 P27 L31 R36 R39 S40 Q41 G42 H44 P46 W47 H51 R53 G56 T57 R70 K73 S76 R77 Y79 G81 V82 H85	C1 R15 L21 R23 P25 L29 R34 R37 S38 Q39 G40 H42 P44 W45 H49 R51 G54 T55 R68 K71 S74 R75 Y77 G79 V80 H83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links