Structure of PDB 6th6 Chain Bj

Receptor sequence
>6th6Bj (length=47) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]
ARFPEAEARIFRKLVCMRCGATNPWGAKKCRKCGYKGLRPKAREPRG
3D structure
PDB6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBj
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bj M18 R19 T23 P25 K30 R32 K37 R40 K42 A43 R47 G48 M17 R18 T22 P24 K29 R31 K36 R39 K41 A42 R46 G47
BS02 ZN Bj C20 C34 C19 C33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum6th6
PubMed32555463
UniProtQ5JJD3|RL40_THEKO Large ribosomal subunit protein eL40 (Gene Name=rpl40e)

[Back to BioLiP]