Structure of PDB 8oit Chain Bi

Receptor sequence

>8oitBi (length=386) Species: 9606 (Homo sapiens)

TPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQF
MKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPPALDLAALRAVAC
DCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAA
AALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQL
AEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHT
QFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWS
EADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQ
SKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEK

3D structure

• PDB: 8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: Bi
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bi	A49 S50 T52 A53 D54 S55 K56 A57 R59 R62 R65 W66 R81 K85 M86 Q87 M89 Y94 T97 F98 R162 H164 R165 Y166 R219 G220 H221 R222 R223 R225 K270 P272 F274 Q277 D304 K305 R307 R310 R313	A11 S12 T14 A15 D16 S17 K18 A19 R21 R24 R27 W28 R43 K47 M48 Q49 M51 Y56 T59 F60 R115 H117 R118 Y119 R172 G173 H174 R175 R176 R178 K223 P225 F227 Q230 D257 K258 R260 R263 R266

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0006915 apoptotic process
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oit, PDBe:8oit, PDBj:8oit
• PDBsum: 8oit
• PubMed: 37141370
• UniProt: Q9NP92|RT30_HUMAN Large ribosomal subunit protein mL65 (Gene Name=MRPS30)