Structure of PDB 8oin Chain Bi

Receptor sequence

>8oinBi (length=387) Species: 9823 (Sus scrofa)

PVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFM
KYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREA
VCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVL
AAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISR
QLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYG
HTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGF
WSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWG
TQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKED

3D structure

• PDB: 8oin Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: Bi
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bi	A49 S50 T52 A53 K54 S55 R59 W66 R81 K85 M86 M89 Y94 T97 F98 P158 R213 G214 H215 R216 K217 R219 K264 F268 R270 Q271 K307 Q308	A10 S11 T13 A14 K15 S16 R20 W27 R42 K46 M47 M50 Y55 T58 F59 P119 R174 G175 H176 R177 K178 R180 K225 F229 R231 Q232 K268 Q269

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome

External links

• PDB: RCSB:8oin, PDBe:8oin, PDBj:8oin
• PDBsum: 8oin
• PubMed: 37141370
• UniProt: A0A480QIM3