Structure of PDB 6xyw Chain Bi

Receptor sequence
>6xywBi (length=101) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
KIKGTKICIAIRSFVNPEKQAWCLPPHTRKVAMPDTRTLYTVLRSPHVDK
KSREQFEMRFKKRFLVIKAQSHELSKKLFWLKRYRILGAQYELQFHCKTR
L
3D structure
PDB6xyw Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
ChainBi
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bi H150 T151 R152 K153 V154 M156 D158 L162 Y163 V165 L166 R167 P169 H170 K173 S175 R176 K185 R186 F187 H27 T28 R29 K30 V31 M33 D35 L39 Y40 V42 L43 R44 P46 H47 K50 S52 R53 K62 R63 F64
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xyw, PDBe:6xyw, PDBj:6xyw
PDBsum6xyw
PubMed32251374
UniProtP42797|RT10_ARATH Small ribosomal subunit protein uS10m (Gene Name=RPS10)

[Back to BioLiP]