Structure of PDB 4v6u Chain Bi

Receptor sequence

>4v6uBi (length=78) Species: 186497 (Pyrococcus furiosus DSM 3638)

KVGSAGRFGARYGLKIRRRVAAVEAKMRQKHTCPVCGRKAVKRISTGIWQ
CQKCGATFAGGAYLPVTPAGKAVRRITE

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: Bi
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bi	K6 V7 G8 S9 G11 R12 G14 A15 R16 Y17 L19 K20 R22 C41 R43 R48 S50 T51	K1 V2 G3 S4 G6 R7 G9 A10 R11 Y12 L14 K15 R17 C36 R38 R43 S45 T46

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8TZI4|RL37A_PYRFU Large ribosomal subunit protein eL43 (Gene Name=rpl37ae)