Structure of PDB 8ove Chain Bh

Receptor sequence

>8oveBh (length=147) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

AAEARKSRDDRRWKRVLAKMDKYHGVGNTRVRGCTRASLFKRTGRKPDNI
VMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTF
IWHKGVKGVPGRVRVRVERKSETRKHFYTVISHIPVPSFKNLTTKVI

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bh	H102 R113 K121 K123 R126 I127 N132 W136 V140 E156 H165 F166	H68 R79 K87 K89 R92 I93 N98 W102 V106 E122 H126 F127
BS02	rna	Bh	D35 R36 W38 K39 R40 Y53 V56 N58 R66 K98 K103 K110	D10 R11 W13 K14 R15 Y23 V26 N28 R32 K64 K69 K76
BS03	rna	Bh	K98 R99 F101 R104 K138 K141	K64 R65 F67 R70 K104 K107
BS04	rna	Bh	H54 G55 R64 R66 T69 R70 A71 F74 R76 T77 K80 H91 K94 K97 K118 R146 K179 N180 L181	H24 G25 R30 R32 T35 R36 A37 F40 R42 T43 K46 H57 K60 K63 K84 R112 K140 N141 L142

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links