Structure of PDB 8ova Chain Bh

Receptor sequence

>8ovaBh (length=156) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

AAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFK
RTGRKPDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDN
RIDASLNTFIWHKGVKGVPGRVRVRVERKSETRKHFYTVISHIPVPSFKN
LTTKVI

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bh	R113 K121 K123 R126 I127 N132 W136 V140 E156 R163 H165 F166	R88 K96 K98 R101 I102 N107 W111 V115 E131 R133 H135 F136
BS02	rna	Bh	R33 W38 K39 R40 K44 Y53 V56 N58 R66 G67 K98 K103 K110	R8 W13 K14 R15 K19 Y28 V31 N33 R41 G42 K73 K78 K85
BS03	rna	Bh	H54 S63 R64 R66 T69 R70 A71 F74 R76 T77 K80 S89 H91 S93 K94 K97 K118 K121 R146 K179 L181	H29 S38 R39 R41 T44 R45 A46 F49 R51 T52 K55 S64 H66 S68 K69 K72 K93 K96 R121 K149 L151
BS04	rna	Bh	K97 K98 R99 F101 R104 K138 K141	K72 K73 R74 F76 R79 K113 K116

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q38DH8

[Back to BioLiP]