Structure of PDB 7uio Chain Bh

Receptor sequence

>7uioBh (length=144) Species: 559292 (Saccharomyces cerevisiae S288C)

GQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSV
TSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYV
RETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFK

3D structure

• PDB: 7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
• Chain: Bh
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	Bh	H45 R48 K117 P120	H16 R19 K88 P91

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0003677 DNA binding
• GO:0003712 transcription coregulator activity
• GO:0003714 transcription corepressor activity
• GO:0005515 protein binding
• GO:0017025 TBP-class protein binding
• GO:0030674 protein-macromolecule adaptor activity

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0032968 positive regulation of transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0016592 mediator complex
• GO:0070847 core mediator complex

External links

• PDB: RCSB:7uio, PDBe:7uio, PDBj:7uio
• PDBsum: 7uio
• PubMed: 36731470
• UniProt: P38304|MED8_YEAST Mediator of RNA polymerase II transcription subunit 8 (Gene Name=MED8)