Structure of PDB 7o7y Chain Bh

Receptor sequence

>7o7yBh (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

PDB

7o7y Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bh	R70 K74 Y78 K79 R84 R89 R93 L95 N96 K97 H98 E100 K105 K106 R109 K110 R112 L113	R69 K73 Y77 K78 R83 R88 R92 L94 N95 K96 H97 E99 K104 K105 R108 K109 R111 L112
BS02	rna	Bh	A2 K3 K5 A6 R10 K35 S42 L44 S45 R48 V49 R51 K52 A55 R56 L58 T59 N62 Q63 K66 R70 K86 T88 R89 R92	A1 K2 K4 A5 R9 K34 S41 L43 S44 R47 V48 R50 K51 A54 R55 L57 T58 N61 Q62 K65 R69 K85 T87 R88 R91

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7o7y, PDBe:7o7y, PDBj:7o7y
PDBsum	7o7y
PubMed	34029205
UniProt	G1SIT5\|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)