Structure of PDB 7aoi Chain Bh |
>7aoiBh (length=91) Species: 5691 (Trypanosoma brucei) [Search protein sequence] |
ALFSCFRCGYMYEFAVSNSYCRKLTLRNDHCPRCDQLTLFRFMSVSGMVG NMPFKPIGVPGPSYATLWWRKTREGKEASAPLDAVCKSDRW |
|
PDB | 7aoi Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit. |
Chain | Bh |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
Bh |
C6 C9 C32 C35 |
C5 C8 C31 C34 |
|
|
|