Structure of PDB 6skg Chain Bh

Receptor sequence

>6skgBh (length=62) Species: 311400 (Thermococcus kodakarensis)

GAGTAPKGKRNRTPTHIRCRRCGRRAFNVKKGYCAACGFGRSRRMRKYSW
SHKWRKKRNLSY

3D structure

• PDB: 6skg Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
• Chain: Bh
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bh	G2 A3 G4 T5 K8 G9 R11 N12 R13 T16 H17 R21 R22 R26 V30 Y34 S43 R45 R47 K48 Y49 S50 W51 S52 H53 K57 K58 R59 N60	G1 A2 G3 T4 K7 G8 R10 N11 R12 T15 H16 R20 R21 R25 V29 Y33 S42 R44 R46 K47 Y48 S49 W50 S51 H52 K56 K57 R58 N59
BS02	ZN	Bh	C20 C23 C35 C38	C19 C22 C34 C37

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6skg, PDBe:6skg, PDBj:6skg
• PDBsum: 6skg
• PubMed: 32555463
• UniProt: Q5JIE1|RL37_THEKO Large ribosomal subunit protein eL37 (Gene Name=rpl37e)