Structure of PDB 4v8z Chain Bh

Receptor sequence
>4v8zBh (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
3D structure
PDB4v8z Molecular architecture of a eukaryotic translational initiation complex.
ChainBh
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bh K74 Y75 R81 R86 R90 T93 K94 F95 K103 K106 I109 K73 Y74 R80 R85 R89 T92 K93 F94 K102 K105 I108
BS02 rna Bh Y7 R10 K45 K49 T56 N59 R63 A82 K83 T85 R86 R89 Y6 R9 K44 K48 T55 N58 R62 A81 K82 T84 R85 R88
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
PDBsum4v8z
PubMed24200810
UniProtP0CX85|RL35B_YEAST Large ribosomal subunit protein uL29B (Gene Name=RPL35B)

[Back to BioLiP]