Structure of PDB 4v5z Chain Bh

Receptor sequence

>4v5zBh (length=166) Species: 9615 (Canis lupus familiaris)

RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMV
SDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKML
SCAGADRLQTGMRGAFGKPQGTVAKVHIGQVIMSIRTKLQNKEHVIEALR
RAKFKFPGRQKIHISK

3D structure

• PDB: 4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
• Chain: Bh
• Resolution: 8.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bh	R6 R9 K12 I32 F33 K38 N99 A105 G106 R115 A117 F118	R4 R7 K10 I30 F31 K36 N97 A103 G104 R113 A115 F116

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:03:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Bh', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Bh', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v5z', asym_id = 'Bh'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v5z', asym_id='Bh')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>