Structure of PDB 4v7j Chain Bg

Receptor sequence
>4v7jBg (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
3D structure
PDB4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
ChainBg
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Bg A2 R3 R4 R6 A7 R10 L12 N28 K29 I30 M31 R32 D33 G34 N37 L38 R76 Y85 R95 S98 R102 R114 A116 R119 W156 A1 R2 R3 R5 A6 R9 L11 N27 K28 I29 M30 R31 D32 G33 N36 L37 R75 Y84 R94 S97 R101 R113 A115 R118 W155
BS02 rna Bg S77 N84 Q86 M144 N148 S76 N83 Q85 M143 N147
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
PDBsum4v7j
PubMed20005802
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]