Structure of PDB 4v6u Chain Bf

Receptor sequence
>4v6uBf (length=51) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MARNKPLAKKLRLAKALKQNRRVPVWVIVKTNRRVLTHPKRRYWRRTKLK
E
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainBf
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bf M1 A2 R3 N4 K5 L7 A8 K10 R12 L13 K15 K18 Q19 R22 W26 V27 V29 K30 T31 N32 R33 H38 P39 K40 R41 R42 Y43 W44 R45 T47 L49 E51 M1 A2 R3 N4 K5 L7 A8 K10 R12 L13 K15 K18 Q19 R22 W26 V27 V29 K30 T31 N32 R33 H38 P39 K40 R41 R42 Y43 W44 R45 T47 L49 E51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U3S6|RL39_PYRFU Large ribosomal subunit protein eL39 (Gene Name=rpl39e)

[Back to BioLiP]