Structure of PDB 8ove Chain Be

Receptor sequence

>8oveBe (length=254) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

GKTVLTCRKGNGSVYQVHGHKRLGPAKLRILDYAERHGFMRGVVKAIEHE
PGRGAPLARVEFRHPYKYRRVKELMVAPEGMFTGQSMLCGVKAPLAIGNV
LPLGQITEGCIVCNVEAKVGDRGTLARASGDYCIIISHNTETGRTRLKLP
SGQKKTVPSSCRAMIGIVAGGGRIEKPVLKAGNSFYRFRGKRNCWPKVRG
VARNPVEHPHGGGNHQHIGHPSTVSRHAPPGQKVGLIAARRTGRIRGSRA
VRGA

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Be	R9 S14 H19 H21 P26 K181 A182 G183 F186 Y187 W196 V199 R204 N205 V207 E208	R8 S13 H18 H20 P25 K180 A181 G182 F185 Y186 W195 V198 R203 N204 V206 E207
BS02	rna	Be	G2 C8 G11 N12 Q17 V18 G20 R23 G25 I31 Y34 R37 G39 F40 R54 R64 Y67 Y69 F83 G85 K119 T125 L126 A127 R128 A129 S130 D132 L150 P151 S152 K156 R174 V179 A182 S185 R193 W196 P197 K198 V199 R200 G201 V202 H211 G213 G214 N215 H216 H218 I219 G220 H221 P222 S223 T224 R227 H228 P230 P231 G232 Q233 G236 I238 A239 A240 R241 R242 T243 G244 R245 R250 R253 G254 A255	G1 C7 G10 N11 Q16 V17 G19 R22 G24 I30 Y33 R36 G38 F39 R53 R63 Y66 Y68 F82 G84 K118 T124 L125 A126 R127 A128 S129 D131 L149 P150 S151 K155 R173 V178 A181 S184 R192 W195 P196 K197 V198 R199 G200 V201 H210 G212 G213 N214 H215 H217 I218 G219 H220 P221 S222 T223 R226 H227 P229 P230 G231 Q232 G235 I237 A238 A239 R240 R241 T242 G243 R244 R249 R252 G253 A254
BS03	rna	Be	K22 H50 Y69 R174 K177 Y187	K21 H49 Y68 R173 K176 Y186

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q57W56

[Back to BioLiP]