Structure of PDB 8evs Chain Be

Receptor sequence
>8evsBe (length=60) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPS
3D structure
PDB8evs Regulation of translation by ribosomal RNA pseudouridylation.
ChainBe
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Be R10 G12 K13 V14 K15 Q17 T18 V21 K23 T24 E25 K26 K28 K31 R33 A34 R37 R42 R43 M56 N57 R9 G11 K12 V13 K14 Q16 T17 V20 K22 T23 E24 K25 K27 K30 R32 A33 R36 R41 R42 M55 N56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum8evs
PubMed37595043
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]