Structure of PDB 6skf Chain Be

Receptor sequence
>6skfBe (length=89) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
MKPMYRSRSWRRKYVRTPGGRTVIHFERRKPKVAHCAMCGRPLNGVPRGR
PSELRKLPKTKKRPERPYPNLCPSCMRKVMKAQVRASIT
3D structure
PDB6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBe
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Be M1 P3 M4 R6 S7 R8 R11 R12 R16 T17 P18 H25 K30 P31 K32 R41 N44 G45 R48 R50 P51 R55 P58 K59 T60 R63 R66 R77 M1 P3 M4 R6 S7 R8 R11 R12 R16 T17 P18 H25 K30 P31 K32 R41 N44 G45 R48 R50 P51 R55 P58 K59 T60 R63 R66 R77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum6skf
PubMed32555463
UniProtQ5JJF7|RL34_THEKO Large ribosomal subunit protein eL34 (Gene Name=rpl34e)

[Back to BioLiP]