Structure of PDB 4v92 Chain Be

Receptor sequence

>4v92Be (length=55) Species: 28985 (Kluyveromyces lactis)

SLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRM
NPGPS

3D structure

• PDB: 4v92 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome.
• Chain: Be
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Be	A9 R10 A11 G12 K13 V14 K15 S16 Q17 T18 P19 K20 V21 E22 K23 T24 N57	A3 R4 A5 G6 K7 V8 K9 S10 Q11 T12 P13 K14 V15 E16 K17 T18 N51
BS02	rna	Be	R55 G59 P60 S61	R49 G53 P54 S55

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:05:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v92', asym_id = 'Be', title = 'Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v92', asym_id='Be', title='Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v92', asym_id = 'Be'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v92', asym_id='Be')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>