Structure of PDB 4v6i Chain Be

Receptor sequence

>4v6iBe (length=239) Species: 4932 (Saccharomyces cerevisiae)

ILTPESQLKKSKAQQKTAEQVAAERAARKAANKEKRAIILERNAAYQKEY
ETAERNIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQL
LRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGK
INKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITVGPHFKQANNFLWPF
KLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKSMN

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: Be
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Be	S16 Q19 Q20 A23 A27 E56 R67 N93 K94 I95 P97 K98 L105 R107 R110 I111 K118 T120 A122 E125 S142 R145 R151 Q159 R160 N166 E170 K196 N199 W203 K206 L207 S208 N209 S211 G212 V216 R218 K219 K241 N244	S11 Q14 Q15 A18 A22 E51 R62 N88 K89 I90 P92 K93 L100 R102 R105 I106 K113 T115 A117 E120 S137 R140 R146 Q154 R155 N161 E165 K191 N194 W198 K201 L202 S203 N204 S206 G207 V211 R213 K214 K236 N239
BS02	rna	Be	K128 F220 H222 I224	K123 F215 H217 I219

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)