Structure of PDB 8ove Chain Bd

Receptor sequence

>8oveBd (length=69) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

AKSKNHTNHNQSRKNHRNGIKPPLPLYMYNSKRGGWLPALVNTRRVRKNN
QKAALKARRERLAAHQAAQ

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bd	K5 N6 H7 T8 N9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 P26 Y28 M29 Y30 S32 N43 T44 R45 R46 V47 K49 N50 N51 Q52 R60	K4 N5 H6 T7 N8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 P25 Y27 M28 Y29 S31 N42 T43 R44 R45 V46 K48 N49 N50 Q51 R59
BS02	rna	Bd	A2 K3 R34 G35	A1 K2 R33 G34

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links