Structure of PDB 8oiq Chain Bd |
>8oiqBd (length=69) Species: 9823 (Sus scrofa) [Search protein sequence] |
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDS LSPEERRARFRKREAKFKE |
|
PDB | 8oiq Molecular basis of translation termination at noncanonical stop codons in human mitochondria. |
Chain | Bd |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Bd |
R43 Q47 |
R9 Q13 |
|
|
|
|