Structure of PDB 8evs Chain Bd

Receptor sequence

>8evsBd (length=53) Species: 4932 (Saccharomyces cerevisiae)

ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR

3D structure

• PDB: 8evs Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: Bd
• Resolution: 2.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U	Bd	F55 R56	F52 R53
BS02	G	Bd	G29 I31 R40	G26 I28 R37
BS03	A	Bd	H10 Y14	H7 Y11
BS04	C	Bd	K16 G17	K13 G14
BS05	G	Bd	Q41 E45	Q38 E42
BS06	C	Bd	W7 F8 S9 H10	W4 F5 S6 H7
BS07	U	Bd	H10 R13 Y14	H7 R10 Y11
BS08	U	Bd	L30 I31 R32	L27 I28 R29
BS09	C	Bd	K16 R19 R32	K13 R16 R29
BS10	A	Bd	Y14 R19	Y11 R16

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 22:50:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8evs', asym_id = 'Bd', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8evs', asym_id='Bd', title='Regulation of translation by ribosomal RNA pseudouridylation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '8evs', asym_id = 'Bd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='8evs', asym_id='Bd')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>