Structure of PDB 4v8m Chain Bd

Receptor sequence

AKSKNHTNHNQSRKNHRNGIKPPLPLYMYNSKRGGWLPALVNTRRVRKNN
QKAALKARRERLAAHQAAQK

3D structure

PDB

4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

Chain

Resolution

5.57 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bd	K3 K5 N6 H7 T8 N9 N11 Q12 K15 H17 R18 N19 L25 Y28 M29 Y30 N31 S32 K33 N43 R46 V47 N51 K53 A55 K57 R60 E61 R62	K2 K4 N5 H6 T7 N8 N10 Q11 K14 H16 R17 N18 L24 Y27 M28 Y29 N30 S31 K32 N42 R45 V46 N50 K52 A54 K56 R59 E60 R61
BS02	rna	Bd	A2 K3 N6 G35 W37 L38	A1 K2 N5 G34 W36 L37

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links