Structure of PDB 4ujc Chain Bd

Receptor sequence

>4ujcBd (length=109) Species: 9986 (Oryctolagus cuniculus)

INEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDT
RLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKN
LQTVNVDEN

3D structure

• PDB: 4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
• Chain: Bd
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bd	T26 N28 H30 K31 R32 H34 G35 F38 K39 R44 L46 K47 R50 I64 T66 N69 K70 W73 K75 I77 R78 N79 Y82 R83 K115 N116 L117 Q118 T119	T10 N12 H14 K15 R16 H18 G19 F22 K23 R28 L30 K31 R34 I48 T50 N53 K54 W57 K59 I61 R62 N63 Y66 R67 K99 N100 L101 Q102 T103

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 10:03:26 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujc', asym_id = 'Bd', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujc', asym_id='Bd', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujc', asym_id = 'Bd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujc', asym_id='Bd')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>