Structure of PDB 7uio Chain Bc

Receptor sequence

>7uioBc (length=107) Species: 559292 (Saccharomyces cerevisiae S288C)

MDSIIPAGVKLDDLQVILAKNENETRDKVCKQINEARDEILPLRLQFNEF
IQIMANIDQEGSKQADRMAKYLHIRDKILQLNDRFQTLSSHLEALQPLFS
TVPEYLK

3D structure

• PDB: 7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
• Chain: Bc
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	THR	Bc	E104 L106 K107	E104 L106 K107
BS02	ALA	Bc	Y105 L106	Y105 L106
BS03	ASP	Bc	L106 K107	L106 K107

Gene Ontology

Molecular Function

• GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
• GO:0003712 transcription coregulator activity
• GO:0003713 transcription coactivator activity
• GO:0005515 protein binding
• GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0032968 positive regulation of transcription elongation by RNA polymerase II
• GO:0034605 cellular response to heat
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0016592 mediator complex
• GO:0070847 core mediator complex

External links

• PDB: RCSB:7uio, PDBe:7uio, PDBj:7uio
• PDBsum: 7uio
• PubMed: 36731470
• UniProt: P40356|MED3_YEAST Mediator of RNA polymerase II transcription subunit 3 (Gene Name=PGD1)