Structure of PDB 4v6i Chain Bc

Receptor sequence

>4v6iBc (length=118) Species: 4932 (Saccharomyces cerevisiae)

GVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIA
CVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
KQRKKQIAFPQRKYAIKA

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: Bc
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bc	K84 R90 F95 E102 R105 Q108 F111 P112 K119 A120	K82 R88 F93 E100 R103 Q106 F109 P110 K117 A118
BS02	rna	Bc	K5 A6 L41 R48 K49 A52 T56 E60 R63 P77 L80 R81 T85 R86 A87 L88 R90	K3 A4 L39 R46 K47 A50 T54 E58 R61 P75 L78 R79 T83 R84 A85 L86 R88

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Feb 21 18:20:13 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v6i', asym_id = 'Bc', title = 'Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v6i', asym_id='Bc', title='Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '4v6i', asym_id = 'Bc'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='4v6i', asym_id='Bc')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>