Structure of PDB 4v5z Chain Bc

Receptor sequence

>4v5zBc (length=257) Species: 9615 (Canis lupus familiaris)

LISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSE
LAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK
TWRRWHRRVNTTQKRYAICSALACLSLPALVMSKGHRIEEVPELPLVVED
KVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRG
PCIIYNEDNGIIKAFRKHPGITLLNVSKLNILKLAPGGHVGRFCIWTESA
FRKLDDL

3D structure

• PDB: 4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
• Chain: Bc
• Resolution: 8.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bc	N46 R48 A57 T61 S62 A71 H84 R85 Q88 R96 F101 R108 W110 R112 R113 Y121 K139 A190 R196 R198	N41 R43 A52 T56 S57 A66 H79 R80 Q83 R91 F96 R103 W105 R107 R108 Y116 K134 A185 R191 R193

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:04:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Bc', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Bc', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v5z', asym_id = 'Bc'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v5z', asym_id='Bc')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>