Structure of PDB 8p2k Chain Bb

Receptor sequence

>8p2kBb (length=108) Species: 9986 (Oryctolagus cuniculus)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMAARAEAIKALVVSRKLHRLAYIAHPKLGRRARARIA
RGLRLSRP

3D structure

• PDB: 8p2k NAC controls cotranslational N-terminal methionine excision in eukaryotes.
• Chain: Bb
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bb	A2 K3 S4 X5 N6 H7 T8 T9 H10 Q12 S13 R14 K15 H17 R18 N19 R25 S26 Q27 R28 Y29 S31 L32 K33 D36 K38 F39 N42 M43 R44 F45 A46 K47 H49 N50 G53 M57 N60 N61 R68 R91 K92 R95 H101 P102 K103 R106 R107 A110 R111 R114 R117 L118 R120	A1 K2 S3 X4 N5 H6 T7 T8 H9 Q11 S12 R13 K14 H16 R17 N18 R24 S25 Q26 R27 Y28 S30 L31 K32 D35 K37 F38 N41 M42 R43 F44 A45 K46 H48 N49 G52 M56 N59 N60 R67 R78 K79 R82 H88 P89 K90 R93 R94 A97 R98 R101 R104 L105 R107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2k, PDBe:8p2k, PDBj:8p2k
• PDBsum: 8p2k
• PubMed: 37347872
• UniProt: G1SGR6|RL29_RABIT Large ribosomal subunit protein eL29 (Gene Name=RPL29)